By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
India Times NowIndia Times NowIndia Times Now
Notification Show More
Font ResizerAa
  • Bharat Shreshtha Ratna Sanman
  • India News
  • Categories
    • Technology
    • Entertainment
    • The Escapist
    • Insider
    • Finance ₹
    • India News
    • Science
    • Health
Reading: Police took independent call on denying permission to CJP event: Parameshwara
Share
India Times NowIndia Times Now
Font ResizerAa
  • Bharat Shreshtha Ratna Sanman
  • India News
  • Categories
Search
  • Bharat Shreshtha Ratna Sanman
  • India News
  • Categories
    • Technology
    • Entertainment
    • The Escapist
    • Insider
    • Finance ₹
    • India News
    • Science
    • Health
Have an existing account? Sign In
Follow US

Home » Police took independent call on denying permission to CJP event: Parameshwara

India News

Police took independent call on denying permission to CJP event: Parameshwara

Times Desk
Last updated: May 23, 2026 4:57 pm
Times Desk
Published: May 23, 2026
Share
SHARE


Home Minister G. Parameshwara on Saturday said that the police had taken an independent call on denying permission for the proposed event of the Cockroach Janata Party (CJP), the satirical digital outfit, after assessing the law and order situation.

Responding to questions by reporters on why the police had denied permission for the CJP convention that was scheduled to be held on Sunday, he said, “The police examine the purpose for which such an event is being organised, who all are involved, and related aspects. Based on that assessment, the police decide whether to grant permission or not. If they have denied permission, there must be some reason.”

A social media post had called a “peaceful human chain” programme near Town Hall on Sunday. However, the police had said no permission had been granted for any such event.

Published – May 23, 2026 10:27 pm IST



Source link

Hospitals registration under ‘Karnataka Arogya Sanjeevini’ entrusted to Suvarna Arogya Suraksha Trust
Three persons held for possession of ganja
77th Republic Day: PM Modi’s deep maroon, golden motif turban steals show
The AIADMK is on a weak footing
Unions, experts blame delay in Aavin milk supply on poor man-management
TAGGED:Bengalurucockroach janata partykarnatakaparameshwarapermission deniedtown hall
Share This Article
Facebook Email Print
Leave a Comment

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe
TelegramFollow

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
[mc4wp_form]
Popular News

Rachakonda She Teams nab 171 offenders in 15 days

Times Desk
Times Desk
October 25, 2025
Winter migratory birds visit Nilgiris in large numbers, buntings recorded for first time
Cabinet gives its nod for completing takeover of metro rail phase one before March 31
BSE smallcap stock gains as company set to raise funds via foreign currency convertible bonds: Details
AR Rahman sings Vande Mataram at Abu Dhabi event amid controversy, Shekhar Kapur reacts
- Advertisement -
Ad imageAd image
Global Coronavirus Cases

Confirmed

0

Death

0

More Information:Covid-19 Statistics
© INDIA TIMES NOW 2026 . All Rights Reserved.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?